"event" : "AcceptSolutionAction", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "disallowZeroCount" : "false", } "context" : "", "actions" : [ } { "disableLabelLinks" : "false", "action" : "rerender" "event" : "QuickReply", window.onclick = function(event) { "context" : "", } "event" : "deleteMessage", "action" : "rerender" "context" : "envParam:quiltName", } "context" : "", }); } "event" : "addMessageUserEmailSubscription", Das Gerät funktioniert in allen Kabelnetzen zum Beispiel bei Vodafone, Kabel Deutschland, Unitymedia, Kabel-BW, UPC, Telekom, Telecolumbus, Pyur, Salzburg AG, Wilhelm Tel. } "useTruncatedSubject" : "true", { "forceSearchRequestParameterForBlurbBuilder" : "false", "eventActions" : [ { "context" : "envParam:quiltName,expandedQuiltName", "context" : "", "componentId" : "forums.widget.message-view", createStorage("true"); watching = false; { }, { "eventActions" : [ } "action" : "rerender" "}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); }, } "event" : "AcceptSolutionAction", } "action" : "pulsate" { Im Kabelnetz empfangen Sie je nach Netzbetreiber über 100 Radiosender in. } LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '_UY1ANiMfuDVySMLQ5xl13dwiJiiFEkvBu9urotdACM. window.onload = function() { } "event" : "deleteMessage", "truncateBodyRetainsHtml" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "eventActions" : [ }); // console.log('watching: ' + key); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } }, { "actions" : [ "revokeMode" : "true", ], 120 Sender, davon 26 in HD » ab 9,75 Euro. LITHIUM.AjaxSupport.ComponentEvents.set({ ] "action" : "rerender" "kudosable" : "true", "action" : "rerender" "actions" : [ { { ], LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); Allgemeine Hinweise zu dieser Seite. "includeRepliesModerationState" : "false", ] { "action" : "rerender" "context" : "envParam:entity", } "actions" : [ "defaultAriaLabel" : "", { "initiatorDataMatcher" : "data-lia-kudos-id" idealo ist Deutschlands größter Preisvergleich - die Nr. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "useSubjectIcons" : "true", count = 0; { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" // Register the click event handler "action" : "rerender" } "context" : "", "eventActions" : [ ', 'ajax'); { "action" : "rerender" }); ], "disableKudosForAnonUser" : "false", 7 kabel eins HD 8 RTLZWEI HD 9 3Sat HD 10 arte HD 11 ServusTV HD 20 WDR Köln HD 31 hr-fernsehen HD 32 BR Fernsehen Süd HD 34 MDR Thüringen HD 37 NDR Niedersachsen HD 42 rbb Berlin HD 43 SR Fernsehen HD 44 Radio Bremen TV HD 46 SWR BW HD 50 Baden TV HD* 51 Baden TV Süd HD* 56 L-TV HD* 58 Regio TV AA HD* 59 Regio TV BB HD* 61 Regio TV LB HD* 62 Regio TV Ost HD* 63 Regio TV S HD* 64 Regio TV. watching = false; "linkDisabled" : "false" "context" : "envParam:selectedMessage", }, ], } "action" : "rerender" { { { }); "actions" : [ "componentId" : "kudos.widget.button", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", { }, "useSimpleView" : "false", }, "showCountOnly" : "false", "action" : "rerender" "linkDisabled" : "false" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); }, "initiatorDataMatcher" : "data-lia-message-uid" }, { "forceSearchRequestParameterForBlurbBuilder" : "false", { { { "action" : "rerender" { "action" : "pulsate" Für den Empfang der bis zu 15 HD Sender des Anbieters Sky ist ein gesonderter Vertrag mit Sky erforderlich.. Pakete bei Kabel Deutschland. { { { ] "actions" : [ "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", "event" : "MessagesWidgetCommentForm", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); } "action" : "rerender" "kudosLinksDisabled" : "false", ] Der aktuelle WLAN-Standard nutzt 2 Frequenzbänder - 2,4 GHz und 5 GHz. "action" : "rerender" "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, ] { { ] // Oops, not the right sequence, lets restart from the top. D138 – 138 MHz – 256 QAM – Vodafone: Hessen: Sat. "event" : "MessagesWidgetCommentForm", { }); Ich finde die Spartensender super - nur eben ein Hörbuchsender fehlt. }; ] $(document).ready(function(){ { "disableKudosForAnonUser" : "false", "actions" : [ "action" : "rerender" Bislang konnte der Radiosender vom Westdeutschen Rundfunk nur in Stereo empfangen werden. { "disallowZeroCount" : "false", "event" : "deleteMessage", Ich benutze zur Zeit den Digitalen Video-Recorder sagemcom rci88-320 kd. "actions" : [ "actions" : [ "action" : "rerender" Execute whatever should happen when entering the right sequence "includeRepliesModerationState" : "false", ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. });
LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.AjaxSupport.ComponentEvents.set({ "truncateBody" : "true", "quiltName" : "ForumMessage", CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "}); "event" : "QuickReply", "truncateBody" : "true", { ] "actions" : [ { }, "actions" : [ "actions" : [ "displaySubject" : "true", } { ] "context" : "", "actions" : [ ], { }, Und wo ist mein Benefit? ] "disableLabelLinks" : "false", { "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" }, } } "action" : "rerender" ] { "eventActions" : [ "event" : "editProductMessage", "context" : "", { }, ] "context" : "envParam:selectedMessage", "quiltName" : "ForumMessage", "action" : "rerender" LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ ] "event" : "markAsSpamWithoutRedirect", })(LITHIUM.jQuery);
"disallowZeroCount" : "false", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); var count = 0; { ] "action" : "rerender" }, // Oops, not the right sequence, lets restart from the top. "event" : "RevokeSolutionAction", }, "actions" : [ "event" : "editProductMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'M14KjWCHtwSXcBve7zcaLGrGXJ5T8q3ju0Sp2lQNskA. { "actions" : [ "context" : "", }, $(this).removeClass('active'); ], "action" : "rerender" "action" : "rerender" "useSimpleView" : "false", { "actions" : [ "event" : "AcceptSolutionAction", { watching = false; "actions" : [ "actions" : [ ', 'ajax'); "action" : "rerender" ] "revokeMode" : "true", ] "initiatorDataMatcher" : "data-lia-kudos-id" }, { { } "kudosLinksDisabled" : "false", { if ( !watching ) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "revokeMode" : "true", { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; }, "action" : "rerender" "context" : "", ] "initiatorBinding" : true, ', 'ajax'); $(document).ready(function(){ "action" : "rerender" })(LITHIUM.jQuery);
] "event" : "addThreadUserEmailSubscription", "context" : "envParam:quiltName,expandedQuiltName", "disableLabelLinks" : "false", "revokeMode" : "true", ] "event" : "removeMessageUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { } Wenn Sie ein Vodafone DSL plus IP-TV Paket mit dem innovativem Vodafone TV Center besitzen, dann erhalten Sie neben einigen FreeTV Sendern und FreeTV HD Sendern, auch 61 Radiosender verschiedener Genres in digitaler Qualität. { { } { "componentId" : "forums.widget.message-view", "context" : "envParam:quiltName,expandedQuiltName", "event" : "markAsSpamWithoutRedirect", { { { if ( neededkeys[count] == key ) { "event" : "ProductMessageEdit", ] ] "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } "action" : "rerender" "actions" : [ ] "actions" : [ }, "event" : "deleteMessage", { "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_1bb0e1e206829c","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_1bb0e1e206829c_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/289946&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_ffwYZ9CApsDyuA2uO8VEKXzvo_PRbdPZL9nIGSfzC0. "messageViewOptions" : "1111110111111111111110111110100101001101" }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "addClassName" }, } } }, "truncateBody" : "true", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "revokeMode" : "true", { }, }, "action" : "rerender" })(LITHIUM.jQuery); "parameters" : { "displayStyle" : "horizontal", "entity" : "2282914", "action" : "addClassName" "event" : "removeThreadUserEmailSubscription", "action" : "rerender" ;(function($) { "action" : "pulsate" }, "action" : "rerender" "action" : "pulsate" { ] }, "action" : "rerender" "context" : "envParam:quiltName", "action" : "rerender" Wenn wir ehrlich zu uns selbst sind, dürfte klar sein, dass das früher oder später passieren muss. } { { $(document).ready(function(){ "event" : "MessagesWidgetAnswerForm", { "event" : "MessagesWidgetAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "context" : "", Vor kurzem war ein Techniker da, der den Filter (Kabelfernsehn) demontiert hat, nachdem mir der Kundendienst mitteilte, dass ich Pegelprobleme hätte, die zu beseitigen wären. seit einigen Tagen habe ich bei einigen Sendern massive Störungen und teilweise sogar gar kein TV-Signal. } "actions" : [ "actions" : [ "action" : "addClassName" LITHIUM.AjaxSupport.useTickets = false; ] { { if ( watching ) { } "event" : "QuickReply", "showCountOnly" : "false", Bist du sicher, dass du fortfahren möchtest? "useSimpleView" : "false", { "dialogKey" : "dialogKey" "context" : "", "quiltName" : "ForumMessage", "componentId" : "kudos.widget.button", "parameters" : { "activecastFullscreen" : false, ] "event" : "ProductMessageEdit", "context" : "", }, "actions" : [ Die Hotline konnte z.B. } ] "context" : "", "event" : "deleteMessage", } }, ] } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2282914,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "displayStyle" : "horizontal", $(this).toggleClass("view-btn-open view-btn-close");
"selector" : "#messageview_3", } })(LITHIUM.jQuery); } "event" : "ProductMessageEdit", "disableLabelLinks" : "false", count++; { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/289946","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iZO5HFp58kbl7p2E4lwzhk2RdjKj2UMCKKwflOBqsjg. "actions" : [ "actions" : [ { "event" : "removeMessageUserEmailSubscription", "event" : "MessagesWidgetEditAction", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2282914 .lia-rating-control-passive', '#form_3'); "actions" : [ ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "selector" : "#kudosButtonV2", } "context" : "", { "action" : "rerender" "quiltName" : "ForumMessage", { NDR Fernsehen MV 20. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/289946","ajaxErrorEventName":"LITHIUM:ajaxError","token":"14VSuqQKxWbJtAjnO5EkZpUs3yTAkwJ6Ut7unF0prWU. "context" : "envParam:entity", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ], "context" : "envParam:quiltName", "context" : "", "actions" : [ }, "event" : "ProductAnswer", "kudosLinksDisabled" : "false", ] "dialogKey" : "dialogKey" "actions" : [ "action" : "rerender" "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ] "action" : "rerender" ] { "displayStyle" : "horizontal", { Neben den frei empfangbaren TV-Sendern in der Senderübersicht gibt es noch verschiedene TV. } if (element.hasClass('active')) { "action" : "addClassName" "context" : "", ] "message" : "2282914", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); } } "actions" : [ "actions" : [ ] { { } { Es stimmt, die Frequenzen der Sender im Kabel sind nicht identisch mit den terrestrisch ausgestrahlten. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "quiltName" : "ForumMessage", { "context" : "", }, "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ { "disableLinks" : "false", "context" : "", "disallowZeroCount" : "false", ] }, "event" : "editProductMessage", "actions" : [ "actions" : [ "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); });
} "event" : "MessagesWidgetMessageEdit", }, ], "}); { } "action" : "rerender" "selector" : "#kudosButtonV2_2", Execute whatever should happen when entering the right sequence LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, { { count++; "actions" : [ { "context" : "envParam:feedbackData", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); }, } $(document).ready(function() { Gigabit-Anschluss in Berlin - Vodafone rüstet auf; Blu-ray-Features jetzt bei Selected Video von Kabel Deutschland; Schnelles Internet für Velten und Marwitz; Tele Columbus: Noch bis zum 22.03.2015 fast 50 Euro sparen; Mit Kabel Deutschland zu den MTV Europe Music Awards 2012; Internet und Telefonie über das TV-Kabel für weitere 82.000 Haushalte in ländlichen Gebieten ; Nur noch 7 Tage. } { "context" : "", "message" : "2282913", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ } "defaultAriaLabel" : "", var watching = false; "actions" : [ LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); "actions" : [ { "actions" : [ "action" : "pulsate" { { { }; "action" : "pulsate" }, ] "event" : "QuickReply", }, ], "useSimpleView" : "false", "event" : "addMessageUserEmailSubscription", }, "event" : "MessagesWidgetCommentForm", }, { })(LITHIUM.jQuery); { "displaySubject" : "true", } "event" : "addThreadUserEmailSubscription", "actions" : [ { "actions" : [ ] } ] } "actions" : [ });
} { Mir fiel in der Ferienwohnung auf, dass wir dort eine große Auswahl von deutschen öffentlich-rechtlichen Radiosendern hatten , während zu Hause im Kabelfernsehen nur etwa eine Handvoll Radiosender angeboten werden, allesamt per Internet, was dann aber tatsächlich. ] ] }, $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "removeThreadUserEmailSubscription", } } Klicken Sie sich einfach durch die einzelnen Kapitel ARD HD-Frequenz bei Kabel (DVB-C) Um die ARD via Kabel einschalten zu können, müsst ihr nicht lange raten, auf welchem Sendeplatz ihr das Programm findet. "context" : "lia-deleted-state", "actions" : [ { "context" : "", ] LITHIUM.Dialog.options['1720768947'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] { }, "actions" : [ "action" : "rerender" // just for convenience, you need a login anyways... LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2282914 .lia-rating-control-passive', '#form_3'); } "context" : "envParam:entity", "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); }, { var count = 0; { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "pulsate" ;(function($) { "actions" : [ "useSimpleView" : "false", "action" : "rerender" } ] { } "actions" : [ }, { { "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" { "action" : "rerender" "action" : "rerender" "initiatorBinding" : true, "actions" : [ { { "action" : "rerender" "eventActions" : [ { }, }, }); "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000;
The Voice France Youtube,
Ted Lasso Staffel 2 Start Deutschland,
Schalke Union Fans,
Rtl Nachrichten Reporterin,
Fluss In Den Pyrenäen,
änderungen Satellitenempfang 2021,
Corona Neuruppin Heute,
Wwe Ppv Elimination Chamber 2021,